FHL1 antibody

• Catalog Number: orb575057
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FHL1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep
• Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat, Sheep
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FHL1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 32kDa
• Target: FHL1
• UniProt ID: Q6IB30
• Protein Sequence: Synthetic peptide located within the following region: YYCVDCYKNFVAKKCAGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKKCS
• NCBI: NP_001440
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: KYOT, SLIM, FCMSU, FHL-1, FHL1A, FHL1B, FLH1A, SLI
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: FHL1, Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: FHL1, Sample Type: Human Fetal Heart, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Host: Rabbit, Target: FHL1, Positive control (+): Human heart muscle, Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.

Human kidney

WB Suggested Anti-FHL1 Antibody Titration: 0.1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Muscle.