You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb402491 |
---|---|
Category | Antibodies |
Description | FH Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, IHC-Fr, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human FH (YDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 49 kDa |
UniProt ID | P07954 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Fumarate hydratase, mitochondrial; Fumarase; 4.2.1 Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of A431 cells using anti-FH antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of PC-3 cells using anti-FH antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of FH using anti-FH antibody.Lane 1:rat lymphaden tissue;2:rat small intestine tissue;3:rat gaster tissue;4:mouse kidney tissue;5:mouse testis tissue;6:mouse gaster tissue;7:human K562 cell;8:human U937 cell;9:human HL-60 cell.
IF analysis of FH using anti-FH antibody.FH was detected in immunocytochemical section of PC-3 cell.
IHC analysis of FH using anti-FH antibody.FH was detected in paraffin-embedded section of human colon cancer tissue.
IHC analysis of FH using anti-FH antibody.FH was detected in paraffin-embedded section of human lung cancer tissue.
IHC analysis of FH using anti-FH antibody.FH was detected in paraffin-embedded section of human placenta tissue.
IHC analysis of FH using anti-FH antibody.FH was detected in paraffin-embedded section of mouse small intestine tissue.
IHC analysis of FH using anti-FH antibody.FH was detected in paraffin-embedded section of human mammary cancer tissue.
FC, ICC, WB | |
Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
EIA, ELISA, IHC, WB | |
Canine, Mouse, Rat | |
Human | |
Goat | |
Polyclonal | |
Unconjugated |
ICC, IF, IHC, WB | |
Human, Monkey, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating