You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb507563 |
---|---|
Category | Antibodies |
Description | FH Antibody (monoclonal, 9D8) |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 9D8 |
Tested applications | ICC, IF, IHC, WB |
Reactivity | Human, Monkey, Mouse, Rat |
Isotype | Mouse IgG2a |
Immunogen | A synthetic peptide corresponding to a sequence of human FH (YDKAAKIAKTAH KNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 48 kDa |
UniProt ID | P07954 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Fumarate hydratase, mitochondrial; Fumarase; FH; Read more... |
Note | For research use only |
Application notes | Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunocytochemistry/Immunofluorescence, 5 μg/ml |
Expiration Date | 12 months from date of receipt. |
WB analysis of FH using anti-FH antibody.Lane 1:K562 cell; 2:human placenta tissue; 3:COS-7 cell; 4:HL-60 cell; 5:Caco-2 cell; 6:U20S cell; 7:A549 cell.
WB analysis of FH using anti-FH antibody.Lane 1:rat thymus tissue; 2:rat testicular tissue; 3:rat stomach tissue; 4:mouse testicular tissue; 5:mouse kidney tissue; 6:NIH3T3 cell.
IHC analysis of FH using anti-FH antibody. FH was detected in paraffin-embedded section of human intestinal cancer tissue.
IHC analysis of FH using anti-FH antibody. FH was detected in paraffin-embedded section of human lung cancer tissue.
IHC analysis of FH using anti-FH antibody. FH was detected in paraffin-embedded section of rat liver tissue.
Filter by Rating