FGFBP2 antibody

• Catalog Number: orb326354
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FGFBP2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FGFBP2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 24kDa
• Target: FGFBP2
• UniProt ID: Q9BYJ0
• Protein Sequence: Synthetic peptide located within the following region: LGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFF
• NCBI: NP_114156
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HBP17RP antibody, anti KSP37 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of Hela cell lysate tissue using FGFBP2 antibody

WB Suggested Anti-FGFBP2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Hela cell lysate.