You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585560 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FGF8 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 24kDa |
Target | FGF8 |
UniProt ID | P55075 |
Protein Sequence | Synthetic peptide located within the following region: LIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLE |
NCBI | NP_149354 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HH6, AIGF, KAL6, FGF-8, HBGF-8 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: FGF8, Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.
WB Suggested Anti-FGF8 Antibody, Titration: 1.0 ug/ml, Positive Control: PANC1 Whole Cell. FGF8 is supported by BioGPS gene expression data to be expressed in PANC1.
IHC-P | |
Bovine, Canine, Gallus, Porcine, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Hamster | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating