You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578305 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FGF2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FGF2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 31 kDa |
Target | FGF2 |
UniProt ID | P09038 |
Protein Sequence | Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
NCBI | NP_001997 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | BFGF, FGFB, FGF-2, HBGF-2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The peptide is present in isoforms of 31, 23, 21 and 17 kDa. The protein is processed to 16 kDa mature form, and the protein may be modified via methylation, phosphorylation and/or sumoylation.
Host: Mouse, Target Name: FGF2, Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: FGF2, Sample Tissue: Human Lung Tumor, Antibody Dilution: 1 ug/ml.
Rabbit Anti-FGF2 Antibody, Catalog Number: orb578305, Formalin Fixed Paraffin Embedded Tissue: Human Ovary Tissue, Observed Staining: Nucleus, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Sample Type: Human A375 cells, Primary Antibody Dilution: 1:100, Secondary Antibody: Anti-rabbit-Alexa-546, Secondary Antibody Dilution: 1:100, Color/Signal Descriptions: Red: FGF2 Blue: Nuclei, Gene Name: FGF2.
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
WB Suggested Anti-FGF2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.
WB Suggested Anti-FGF2 Antibody Titration: 2 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate.
ICC, IF, IHC-P, WB | |
Guinea pig, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P | |
Bovine, Guinea pig, Sheep | |
Canine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating