FEM1B antibody

• Catalog Number: orb582186
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FEM1B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FEM1B
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 69kDa
• Target: FEM1B
• UniProt ID: Q9UK73
• Protein Sequence: Synthetic peptide located within the following region: DKSTTGVSEILLKTQMKMSLKCLAARAVRANDINYQDQIPRTLEEFVGFH
• NCBI: NP_056137
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: F1AA, F1A-ALPHA, FEM1-beta
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: FEM1B, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Lanes: 1: 30 ug HEK293T cell lysate, 2: 30 ug 3FLAG-hFEM1B transfected HEK293T cell lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:8000, Gene Name: FEM1B, FEM1B is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.

WB Suggested Anti-FEM1B Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Lung.