You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1820825 |
---|---|
Category | Proteins |
Description | The Feline SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline SCF applications are for cell culture, ELISA standard, and Western Blot Control. The Feline SCF yeast-derived recombinant protein can be purchased in multiple sizes. Feline SCF Specifications: (Molecular Weight: 27.9 kDa) (Amino Acid Sequence: GLCRNRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEGHSSENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248)) (Gene ID: 493937). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 27.9 kDa |
Target | SCF |
Entrez | 493937 |
Protein Sequence | GLCRNRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEGHSSENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248) |
Protein Length | 248 |
Source | Yeast |
Storage | -20°C |
Alternative names | Kit Ligand; Stem Cell Factor Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Filter by Rating