Cart summary

You have no items in your shopping cart.

    Feline M-CSF Recombinant Protein

    Feline M-CSF Recombinant Protein

    Catalog Number: orb1819766

    DispatchUsually dispatched within 5-10 working days
    $ 250.00
    Catalog Numberorb1819766
    CategoryProteins
    DescriptionThe Feline M-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline M-CSF applications are for cell culture, ELISA standard, and Western Blot Control. Feline M-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Feline M-CSF Specifications: (Molecular Weight: 18.4 kDa) (Amino Acid Sequence: EEVSERCSHMIGNGHLQFLQQLIDSQMETSCQIAFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFKDNTPNANVIVTLQELSLRLSSCFTKDYEEQDKACVRTFHETPLQLLEKIKNVFNETKNLLKKDWNVFSKNCNKSFEKCSSQGHDRQQEGP (158)) (Gene ID: 101091467).
    Form/AppearanceLyophilized
    Purity98%
    MW18.4 kDa
    TargetM-CSF
    Entrez101091467
    Protein SequenceEEVSERCSHMIGNGHLQFLQQLIDSQMETSCQIAFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFKDNTPNANVIVTLQELSLRLSSCFTKDYEEQDKACVRTFHETPLQLLEKIKNVFNETKNLLKKDWNVFSKNCNKSFEKCSSQGHDRQQEGP (158)
    Protein Length158
    SourceYeast
    Storage-20°C
    NoteFor research use only
    Expiration Date6 months from date of receipt.
    • Feline M-CSF protein [orb1215807]

      98%

      18.4 kDa

      Yeast

      25 μg
    • Human CSF1R Protein [orb1516736]

      > 90% as determined by SDS-PAGE

      60 kDa

    • Human CSF1R Protein (Biotin) [orb1516471]

      > 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC

      Due to glycosylation, the protein migrates to 75-105 kDa based on Tris-Bis PAGE result. kDa

    • Human CSF1R Protein [orb1516472]

      > 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC

      Due to glycosylation, the protein migrates to 75-105 kDa based on Tris-Bis PAGE result. kDa

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars