You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1216320 |
---|---|
Category | Proteins |
Description | The Feline IFN gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IFN gamma applications are for cell culture, ELISA standard, and Western Blot Control. The Feline IFN gamma yeast-derived recombinant protein can be purchased in multiple sizes. Feline IFN gamma Specifications: (Molecular Weight: 17.0 kDa) (Amino Acid Sequence: QAMFFKEIEE LKGYFNASNP DVADGGSLFV DILKNWKEES DKTIIQSQIV SFYLKMFENL KDDDQRIQRS MDTIKEDMLD KLLNTSSSKR DDFLKLIQIP VNDLQVQRKA INELFKVMND LSPRSNLRKR KRSQNLFRGR RASK (144)) (Gene ID: 493965). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 17.0 kDa |
Target | IFN gamma |
Entrez | 493965 |
Protein Sequence | QAMFFKEIEELKGYFNASNPDVADGGSLFVDILKNWKEESDKTIIQSQIVSFYLKMFENLKDDDQRIQRSMDTIKEDMLDKLLNTSSSKRDDFLKLIQIPVNDLQVQRKAINELFKVMNDLSPRSNLRKRKRSQNLFRGRRASK (144) |
Protein Length | 144 |
Source | Yeast |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Filter by Rating