You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1291248 |
---|---|
Category | Proteins |
Description | The Feline CCL17 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline CCL17 applications are for cell culture, ELISA standard, and Western Blot Control. Feline CCL17 yeast-derived recombinant protein can be purchased in multiple sizes. Feline CCL17 Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: VLSGALCFRM KDAELKVLYL HDNQLLAGRL HAGNIIQGEE ISVVPNRSLD AKLSPVILGV QGGSQCLSCG TGQEPTLKLE PVNIMELYLG AKESKSFTFY RRDTGLTSSF ESAAYPGWFL CTVPEADQPL RLTQLSEDAS WDSPITDFYF QQCD (154)) (Gene ID: 101097230). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 8.5 kDa |
Target | CCL17 |
Entrez | 493832 |
Protein Sequence | ARATNVGRECCLEYFKGAIPLRRLTGWYRTSGECSKDAIVFVTIHGKSICSDPKDTRVKKTVRYLQSIMNPVPQE (75) |
Protein Length | 75 |
Source | Yeast |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Filter by Rating