FCGR2B Rabbit Polyclonal Antibody

• Catalog Number: orb585683
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CD32b
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Human
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 34kDa
• Target: FCGR2B
• UniProt ID: P31994
• Protein Sequence: Synthetic peptide located within the following region: CREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDALEEPDDQNRI
• NCBI: NP_001002275
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CD32, FCG2, CD32B, FCGR2, IGFR2, FCGR2C, FcRII-c
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-FCGR2B antibody, Formalin Fixed Paraffin Embedded Tissue: Human Placenta, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-FCGR2B antibody, Formalin Fixed Paraffin Embedded Tissue: Human Thyroid, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-FCGR2B Antibody, Titration: 1.0 ug/ml, Positive Control: Placenta.