FCGR2B Rabbit Polyclonal Antibody

• Catalog Number: orb585682
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CD32b
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 32kDa
• Target: FCGR2B
• UniProt ID: P31994
• Protein Sequence: Synthetic peptide located within the following region: VALIYCRKKRISANPTNPDEADKVGAENTITYSLLMHPDALEEPDDQNRI
• NCBI: NP_001002273
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CD32, FCG2, CD32B, FCGR2, IGFR2, FCGR2C, FcRII-c
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. FCGR2B is supported by BioGPS gene expression data to be expressed in 721_B.

WB Suggested Anti-FCGR2B Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Lung.