FBXW2 antibody

• Catalog Number: orb330283
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FBXW2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FBXW2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 51kDa
• Target: FBXW2
• UniProt ID: Q9UKT8
• Protein Sequence: Synthetic peptide located within the following region: SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI
• NCBI: NP_036296
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FBW2 antibody, anti Fwd2 antibody, anti MGC11
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: CHAD, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: FBXW2, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: FBXW2, Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: FBXW2, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target: FBXW2, Positive control (+): Human Placenta (PL), Negative control (-): 293T Cell Lysate (2T), Antibody concentration: 1 ug/mL.

WB Suggested Anti-FBXW2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate, FBXW2 is supported by BioGPS gene expression data to be expressed in Jurkat.