You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578790 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FBXO11 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ChIP, WB |
Predicted Reactivity | Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FBXO11 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 94kDa |
Target | FBXO11 |
UniProt ID | Q6DF73 |
Protein Sequence | Synthetic peptide located within the following region: HDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQ |
NCBI | NP_079409 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | UBR6, VIT1, FBX11, PRMT9, IDDFBA, UG063H01 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: FBXO11, Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1.0 ug/ml.
Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
WB Suggested Anti-FBXO11 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate. FBXO11 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.
Filter by Rating