You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578730 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FBXL7 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FBXL7 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 54kDa |
Target | FBXL7 |
UniProt ID | Q9UJT9 |
Protein Sequence | Synthetic peptide located within the following region: IRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWD |
NCBI | NP_036436 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | FBL6, FBL7 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: FBXL7, Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target: FBXL7, Positive control (+): Ovary tumor (T-OV), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/ml.
Human kidney
WB Suggested Anti-FBXL7 Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate.
Filter by Rating