You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582400 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FAU |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FAU |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 8 kDa |
Target | FAU |
UniProt ID | P62861 |
Protein Sequence | Synthetic peptide located within the following region: VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS |
NCBI | NP_001988 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | S30, FAU1, Fub1, Fubi, asr1, RPS30, MNSFbeta Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: FAU, Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. FAU is supported by BioGPS gene expression data to be expressed in Jurkat.
Host: Rabbit, Target Name: FAU, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. FAU is supported by BioGPS gene expression data to be expressed in MCF7.
Rabbit Anti-FAU Antibody, Catalog Number: orb582400, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.
WB Suggested Anti-FAU Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate. FAU is supported by BioGPS gene expression data to be expressed in 721_B.
WB Suggested Anti-FAU antibody Titration: 1 ug/ml, Sample Type: Human liver.
IHC-P, WB | |
Hamster, Porcine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating