Fatty Acid Binding Protein 5/FABP5 Antibody

• Catalog Number: orb412979
• Category: Antibodies
• Description: Fatty Acid Binding Protein 5/FABP5 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IF, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of mouse FABP5 (KWRLMESHGFEEYMKELGVGLALRKMAAMAKPD).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 15 kDa
• UniProt ID: Q05816
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of FABP5 using anti-FABP5 antibody.Lane 1:human HeLa cell;2:human A549 cell;3:rat thymus tissue;4:mouse thymus tissue.

IF analysis of FABP5 using anti-FABP5 antibody. FABP5 was detected in an immunocytochemical section of U20S cells.

IHC analysis of FABP5 using anti-FABP5 antibody.FABP5 was detected in paraffin-embedded section of human lung cancer tissue.

IHC analysis of FABP5 using anti-FABP5 antibody.FABP5 was detected in paraffin-embedded section of human oesophagus squama cancer tissue.

IHC analysis of FABP5 using anti-FABP5 antibody.FABP5 was detected in paraffin-embedded section of mouse lung tissue.

IHC analysis of FABP5 using anti-FABP5 antibody.FABP5 was detected in paraffin-embedded section of rat lung tissue.