FANCL antibody

• Catalog Number: orb330840
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FANCL
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Rabbit
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FANCL
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 43 kDa
• Target: FANCL
• UniProt ID: Q9NW38
• Protein Sequence: Synthetic peptide located within the following region: ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIY
• NCBI: NP_001108108
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FAAP43 antibody, anti FLJ10335 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment.

Host: Rabbit, Target Name: FANCL, Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: FANCL, Sample Tissue: Human Hela Whole Cell, Antibody dilution: 2 ug/ml.

Lanes: Lane 1: 7 ug HEK293 cytoplasmic lysate, 2: 7 ug HEK293 nuclei lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:3000, Gene Name: FANCL.

Rabbit Anti-FANCL Antibody, Catalog Number: orb330840, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic and nuclear in in pinealocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-FANCL Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human heart.