FAM108A1 antibody

• Catalog Number: orb586821
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FAM108A1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM108A1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 39kDa
• Target: ABHD17A
• UniProt ID: H2R6I8
• Protein Sequence: Synthetic peptide located within the following region: VPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIEKVSKI
• NCBI: NP_112490
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: C19orf27, FAM108A1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: FAM108A1, Sample Type: Fetal Brain lysates, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: FAM108A1, Sample Type: Human 293T, Antibody dilution: 1.0 ug/ml. ABHD17A is supported by BioGPS gene expression data to be expressed in HEK293T.

Host: Rabbit, Target Name: FAM108A1, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: FAM108A1, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: FAM108A1, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: FAM108A1, Sample Type: Human Jurkat, Antibody dilution: 1.0 ug/ml. ABHD17A is supported by BioGPS gene expression data to be expressed in Jurkat.