FAH antibody

• Catalog Number: orb578162
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FAH
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FAH
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46kDa
• Target: FAH
• UniProt ID: P16930
• Protein Sequence: Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG
• NCBI: NP_000128
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemistry with human liver, mouse KO tissue.

FAH antibody - C-terminal region (orb578162) validated by WB using Jurkat cell lysate at 2.5 ug/ml.

Host: Mouse, Target Name: FAH, Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.

Immunohistochemistry with human liver, mouse KO tissue.

Rabbit Anti-FAH Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Sample Type: Human Liver and Mouse FAH KO liver, Primary Dilution: 1:400.