FAH antibody

• Catalog Number: orb578161
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FAH
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAH
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46 kDa
• Target: FAH
• UniProt ID: P16930
• Protein Sequence: Synthetic peptide located within the following region: SFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFT
• NCBI: NP_000128
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Host: Mouse, Target Name: FAH, Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: FAH, Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: FAH, Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: FAH, Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target: FAH, Positive control (+): Human lung (LU), Negative control (-): Human brain (BR), Antibody concentration: 1 ug/ml.

Immunohistochemistry with human kidney.

Immunohistochemistry with human liver.

Sample Type: Human Liver and Mouse FAH KO liver, Primary Dilution: 1:400.

WB Suggested Anti-FAH Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Liver.