You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585799 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FADS2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FADS2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 48 kDa |
Target | FADS2 |
UniProt ID | O95864 |
Protein Sequence | Synthetic peptide located within the following region: VFYFGNGWIPTLITAFVLATSQAQAGWLQHDYGHLSVYRKPKWNHLVHKF |
NCBI | NP_004256 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | D6D, DES6, TU13, FADSD6, LLCDL2, SLL0262 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
IHC - Paraffin (10 ug/ml).
IHC - Paraffin (10 ug/ml).
Filter by Rating