You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330236 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FADS1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human FADS1 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 49kDa |
Target | FADS1 |
UniProt ID | O60427 |
Protein Sequence | Synthetic peptide located within the following region: FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL |
NCBI | NP_037534 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti BC269730_2 antibody, anti D5D antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: FADS1, Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.
Human Muscle
WB Suggested Anti-FADS1 Antibody Titration: 2.5 ug/mL, Positive Control: K562 cell lysate, FADS1 is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells.
ICC, IHC-Fr, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating