FADS1 antibody

• Catalog Number: orb330236
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FADS1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FADS1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 49kDa
• Target: FADS1
• UniProt ID: O60427
• Protein Sequence: Synthetic peptide located within the following region: FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL
• NCBI: NP_037534
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti BC269730_2 antibody, anti D5D antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: FADS1, Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Human Muscle

WB Suggested Anti-FADS1 Antibody Titration: 2.5 ug/mL, Positive Control: K562 cell lysate, FADS1 is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells.