Factor VIII antibody

• Catalog Number: orb333731
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Factor VIII
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Human, Rabbit, Sheep
• Reactivity: Canine, Equine, Human, Sheep
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human F8
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 79kDa
• Target: F8
• UniProt ID: P00451
• Protein Sequence: Synthetic peptide located within the following region: IMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQ
• NCBI: NP_000123
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Anti-F8 antibody, anti-F8b antibody, anti-F8c anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of 721_B Whole Cell tissue using factor viii antibody

Western blot analysis of 721_B cell lysate tissue using factor viii antibody

Host: Rabbit, Target Name: F8, Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: F8, Sample Type: 721_B Whole Cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 0.12%.

WB Suggested Anti-F8 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate.