You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329754 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FABP4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Goat, Human, Mouse, Rabbit, Rat, Sheep |
Reactivity | Canine, Equine, Goat, Human, Mouse, Rat, Sheep |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FABP4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 15kDa |
Target | FABP4 |
UniProt ID | P15090 |
Protein Sequence | Synthetic peptide located within the following region: FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM |
NCBI | NP_001433 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti A-FABP antibody, anti aP2 antibody, anti ALBP Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Muscle tissue using FABP4 antibody
Immunohistochemical staining of human brain tissue using FABP4 antibody
Brain, cortex.
Host: Rabbit, Target Name: FABP4, Sample Tissue: Human Stomach Tumor, Antibody Dilution: 1.0 ug/mL.
WB Suggested Anti-FABP4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Muscle.
IHC, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating