F3 monoclonal antibody (M01A), clone 4G4

• Catalog Number: orb2293141
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant F3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4G4
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: F3 (AAH11029, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK
• NCBI: AAH11029
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In ascites fluid
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

F3 monoclonal antibody (M01A), clone 4G4 Western Blot analysis of F3 expression in A-431.

F3 monoclonal antibody (M01A), clone 4G4. Western Blot analysis of F3 expression in Jurkat.

Western Blot analysis of F3 expression in transfected 293T cell line by F3 monoclonal antibody (M01A), clone 4G4. Lane 1: F3 transfected lysate (33.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.84 KDa).