You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578202 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to F2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Sheep, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human F2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 70 kDa |
Target | F2 |
UniProt ID | P00734 |
Protein Sequence | Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE |
NCBI | NP_000497 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PT, THPH1, RPRGL2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Protein is processed to prothrombin and the peptide also is contained in the b-chain form of ~30 kDa as well as a 32 kDa form of prothrombin. Peptide aligns to amino acids 419-432 kDa in the full length form.
Anti-F2 / Thrombin antibody IHC staining of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Anti-F2 / Thrombin antibody IHC staining of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Host: Rabbit, Target Name: F2, Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target: F2, Positive control (+): HepG2 (HG), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.
Rabbit Anti-F2 Antibody, Paraffin Embedded Tissue: Human Placenta, Antibody Concentration: 5 ug/ml.
WB Suggested Anti-F2 Antibody, Titration: 1 ug/ml, Positive Control: 721_B cell lysate.
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating