EYA1 antibody

• Catalog Number: orb329658
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EYA1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EYA1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 64 kDa
• Target: EYA1
• UniProt ID: Q99502
• Protein Sequence: Synthetic peptide located within the following region: QDYPSYPSFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNATYQLQEPP
• NCBI: NP_742057
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti BOP antibody, anti BOR antibody, anti MGC1418
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL.

Host: Rabbit, Target Name: EYA1, Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: EYA1, Sample Tissue: Human ACHN Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: EYA1, Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: EYA1, Sample Tissue: Human PC-3 Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: EYA1, Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: EYA1, Sample Tissue: Human U937 Whole Cell, Antibody Dilution: 1 ug/mL.

Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0 ug/mL using anti-EYA1 antibody (orb329658).

WB Suggested Anti-EYA1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human brain.