You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1140521 |
---|---|
Category | Proteins |
Description | Glucagon like peptide 1 (GLP-1) receptor agonist; Peptides. |
CAS Number | 141758-74-9 |
Form/Appearance | Freeze dried solid |
Purity | > 95% by HPLC |
MW | 4186.6 Da |
Formula | C184H282N50O60S |
Solubility (25°C) | Soluble in water (10mg/mL), PBS, dilute acid and DMSO. |
Protein Sequence | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
Storage | Store desiccated at -20°C in the dark |
Alternative names | 141758-74-9, Exenatide, Exendin-4GH001, GLP-1, HGE Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
> 96 % by SDS-PAGE and HPLC analyses. | |
Approximately 4.2 kDa, a single non-glycosylated polypeptide chain containing 39 amino acids. | |
Escherichia coli |
Filter by Rating