You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1140522 |
---|---|
Category | Proteins |
Description | Glucagon like peptide 1 (GLP-1) receptor antagonist; Peptides. |
CAS Number | 196109-31-6 |
Form/Appearance | Freeze dried solid |
Purity | > 95% by HPLC |
MW | 3992.4 Da |
Formula | C176H272N46O58S |
Solubility (25°C) | Soluble in dilute acid |
Protein Sequence | EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
Storage | Store desiccated, frozen and in the dark |
Alternative names | 196109-31-6, EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Filter by Rating