You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592832 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ETS1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ETS1 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 50kDa |
Target | ETS1 |
UniProt ID | P14921 |
Protein Sequence | Synthetic peptide located within the following region: TFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMN |
NCBI | NP_005229 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | p54, ETS-1, EWSR2, c-ets-1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: ETS1, Sample Tissue: Human NCI-H226 Whole Cell, Antibody Dilution: 7 ug/ml.
Host: Rabbit, Target: ETS1, Positive control (+): Hela (HL), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.
Human kidney
Human Pancrease
Rabbit Anti-ETS1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-ETS1 Antibody Titration: 1.0 ug/ml, Positive Control: HepG2 cell lysate.
FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FACS, IF, IHC-P | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating