You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330500 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ERVW-1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human ERVW-1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 60 kDa |
Target | ERVW-1 |
UniProt ID | Q9UQF0 |
Protein Sequence | Synthetic peptide located within the following region: CMTSSSPYQEFLWRMQRPGNIDAPSYRSLSKGTPTFTAHTHMPRNCYHSA |
NCBI | NP_055405 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti ENV antibody, anti ENVW antibody, anti ERVWE1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
Host: Rabbit, Target Name: ERVW-1, Sample Type: HT1080 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target: ERVW-1, Positive control (+): Human Placenta (PL), Negative control (-): 293T (2T), Antibody concentration: 1 ug/mL.
Filter by Rating