ERLIN2 antibody

• Catalog Number: orb326257
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ERLIN2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human, Mouse, Porcine, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ERLIN2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 38kDa
• Target: ERLIN2
• UniProt ID: O94905
• Protein Sequence: Synthetic peptide located within the following region: ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN
• NCBI: NP_009106
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti C8orf2 antibody, anti Erlin-2 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Fetal Lung tissue using ERLIN2 antibody

Western blot analysis of human Fetal Heart tissue using ERLIN2 antibody

Western blot analysis of human Fetal Brain tissue using ERLIN2 antibody

Western blot analysis of human 721_B tissue using ERLIN2 antibody

Western blot analysis of 293T cell lysate tissue using ERLIN2 antibody

Western blot analysis of human HeLa, AT3 tissue using ERLIN2 antibody

Western blot analysis of human Placenta tissue using ERLIN2 antibody

ERLIN2 antibody - middle region (orb326257) validated by WB using HeLa, aT3 cells at 1:200 / 1:1000.

Host: Rabbit, Target Name: ERLIN2, Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: ERLIN2, Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: ERLIN2, Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: ERLIN2, Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: ERLIN2, Sample Type: 721_B, Antibody Dilution: 1.0 ug/mL, ERLIN2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Host: Rabbit, Target Name: ERLIN2, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: ERLIN2, Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: ERLIN2, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: ERLIN2, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

WB Suggested Anti-ERLIN2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: 293T cell lysate, ERLIN2 is strongly supported by BioGPS gene expression data to be expressed in HEK293T.