ERK1/2 antibody

• Catalog Number: orb584155
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ERK1/2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Zebrafish
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MAPK1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 41 kDa
• Target: MAPK1
• UniProt ID: P28482
• Protein Sequence: Synthetic peptide located within the following region: PYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
• NCBI: NP_620407
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ERK, p38, p40, p41, ERK2, ERT1, NS13, ERK-2, MAPK2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

Host: Rabbit, Target Name: MAPK1, Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: MAPK1, Sample Type: Human Jurkat, Antibody dilution: 1.0 ug/ml. MAPK1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

Host: Rat, Target Name: MAPK1, Sample Tissue: Rat Skeletal Muscle, Antibody dilution: 1 ug/ml.

Rabbit Anti-MAPK1 Antibody, Catalog Number: orb584155, Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-MAPK1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.