ERCC8 antibody

• Catalog Number: orb573839
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ERCC8
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Equine, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ERCC8
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 44kDa
• Target: ERCC8
• UniProt ID: Q13216
• Protein Sequence: Synthetic peptide located within the following region: QELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG
• NCBI: NP_000073
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CSA, CKN1, UVSS2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: ERCC8, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: ERCC8, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: ERCC8, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: ERCC8, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: ERCC8, Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml. ERCC8 is supported by BioGPS gene expression data to be expressed in HepG2.

Host: Rabbit, Target Name: ERCC8, Sample Type: MCF7 Whole Cell lysates, Antibody dilution: 1.0 ug/ml.

Human Liver

Human Muscle

WB Suggested Anti-ERCC8 Antibody Titration: 0.1-5.0 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.

WB Suggested Anti-ERCC8 antibody Titration: 1 ug/ml, Sample Type: Human liver.