You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1216277 |
---|---|
Category | Proteins |
Description | The Equine VEGF-A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine VEGF-A applications are for cell culture, ELISA standard, and Western Blot Control. The Equine VEGF-A yeast-derived recombinant protein can be purchased in multiple sizes. Equine VEGF-A Specifications: (Molecular Weight: 19.2 kDa) (Amino Acid Sequence: APMAEGEHKTHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTAEFNITMQIMRIKPHQSQHIGEMSFLQHSKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR (164)) (Gene ID: 100033839). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 19.2 kDa |
Target | VEGF-A |
Entrez | 100033839 |
Protein Sequence | APMAEGEHKTHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTAEFNITMQIMRIKPHQSQHIGEMSFLQHSKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR (164) |
Protein Length | 164 |
Source | Yeast |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Filter by Rating