You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1216278 |
---|---|
Category | Proteins |
Description | The Equine IL-8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-8 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-8 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-8 Specifications: (Molecular Weight: 8.9 kDa) (Amino Acid Sequence: AVVSRITAELRCQCIKTHSKPFNPKLIKEMRVIESGPHCENSEIIVKLVNGAEVCLNPHTKWVQIIVQAFLKRAEGQNP (79)) (Gene ID: 100037400). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 8.9 kDa |
Target | IL-8 |
Entrez | 100037400 |
Protein Sequence | AVVSRITAELRCQCIKTHSKPFNPKLIKEMRVIESGPHCENSEIIVKLVNGAEVCLNPHTKWVQIIVQAFLKRAEGQNP (79) |
Protein Length | 79 |
Source | Yeast |
Storage | -20°C |
Alternative names | CXCL8 Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Filter by Rating