You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb413054 |
---|---|
Category | Antibodies |
Description | epithelial Sodium Channel alpha/SCNN1A Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ICC, IF, WB |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human SCNN1A (QEWVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYK). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 76 kDa |
UniProt ID | P37088 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Amiloride-sensitive sodium channel subunit alpha; Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of SCNN1A using anti-SCNN1A antibody.Lane 1:human COLO-320 cell;2:human HepG2 cell;3:human A549 cell.
IF analysis of SCNN1A using anti-SCNN1A antibody.SCNN1A was detected in immunocytochemical section of A431 cell.
IF analysis of SCNN1A using anti-SCNN1A antibody.SCNN1A was detected in immunocytochemical section of A431 cell.
ELISA, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating