ENTPD6 monoclonal antibody (M03), clone 2D10

• Catalog Number: orb2294802
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ENTPD6.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2D10
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: ENTPD6 (NP_001238, 386 a.a. ~ 484 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: YDLAAGVGLIDAEKGGSLVVGDFEIAAKYVCRTLETQPQSSPFSCMDLTYVSLLLQEFGFPRSKVLKLTRKIDNVETSWALGAIFHYIDSLNRQKSPAS
• NCBI: NP_001238
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoperoxidase of monoclonal antibody to ENTPD6 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml].

Western Blot detection against Immunogen (36.63 KDa).