ENTPD6 antibody

• Catalog Number: orb586798
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ENTPD6
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human ENTPD6
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 34kDa
• Target: ENTPD6
• UniProt ID: O75354
• Protein Sequence: Synthetic peptide located within the following region: ALRMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSP
• NCBI: NP_001107561.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CD39L2, IL6ST2, IL-6SAG, NTPDase-6, dJ738P15.3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: ENTPD6, Sample Type: Hela Whole cell lysates, Antibody dilution: 1.0 ug/ml.