Enterotoxin type C-2 Protein, S. aureus, Recombinant

• Catalog Number: orb1976379
• Category: Proteins
• Description: Staphylococcal enterotoxin that activates the host immune system by binding as unprocessed molecules to major histocompatibility (MHC) complex class II and T-cell receptor (TCR) molecules. In turn, this ternary complex activates a large number of T-lymphocytes initiating a systemic release of proinflammatory cytokines. Causes also the intoxication staphylococcal food poisoning syndrome. Enterotoxin type C-2 Protein, S. aureus, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 27.6 kDa and the accession number is P34071.
• Tag: Tag Free
• Purity: 98.00%
• MW: 27.6 kDa (predicted)
• UniProt ID: P34071
• Protein Sequence: ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
• Expression System: E. coli
• Biological Origin: Staphylococcus aureus
• Biological Activity: Staphylococcal enterotoxin that activates the host immune system by binding as unprocessed molecules to major histocompatibility (MHC) complex class II and T-cell receptor (TCR) molecules. In turn, this ternary complex activates a large number of T-lymphocytes initiating a systemic release of proinflammatory cytokines. Causes also the intoxication staphylococcal food poisoning syndrome. Enterotoxin type C-2 Protein, S. aureus, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 27.6 kDa and the accession number is P34071.
• Expression Region: 28-266 aa
• Storage: -20°C
• Note: For research use only
• Application notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
• Expiration Date: 6 months from date of receipt.