You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575056 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ENO1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ENO1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 47kDa |
Target | ENO1 |
UniProt ID | Q53HR3 |
Protein Sequence | Synthetic peptide located within the following region: VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDP |
NCBI | NP_001419 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | NNE, PPH, MPB1, ENO1L1, HEL-S-17 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Human kidney
Rabbit Anti-ENO1 Antibody, Catalog Number: orb575056, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Membrane, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-ENO1 Antibody, Paraffin Embedded Tissue: Human placenta cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-ENO1 Antibody Titration: 0.03 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Small Intestine.
WB Suggested Anti-ENO1 antibody Titration: 1 ug/ml, Sample Type: Human heart.
WB Suggested Anti-ENO1 antibody Titration: 1 ug/ml, Sample Type: Human liver.
ELISA, FC, IF, IHC, IP, WB | |
Human, Mouse, Rabbit, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
ELISA, FC, IF, IP, WB | |
Human, Mouse, Rabbit, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
FC, ICC, IF, IHC, WB | |
Human, Monkey, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating