ENO1 antibody

• Catalog Number: orb575056
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ENO1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ENO1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47kDa
• Target: ENO1
• UniProt ID: Q53HR3
• Protein Sequence: Synthetic peptide located within the following region: VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDP
• NCBI: NP_001419
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NNE, PPH, MPB1, ENO1L1, HEL-S-17
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human kidney

Rabbit Anti-ENO1 Antibody, Catalog Number: orb575056, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Membrane, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-ENO1 Antibody, Paraffin Embedded Tissue: Human placenta cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-ENO1 Antibody Titration: 0.03 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Small Intestine.

WB Suggested Anti-ENO1 antibody Titration: 1 ug/ml, Sample Type: Human heart.

WB Suggested Anti-ENO1 antibody Titration: 1 ug/ml, Sample Type: Human liver.