Emerin EMD Antibody (monoclonal, 5A10)

• Catalog Number: orb421117
• Category: Antibodies
• Description: Emerin EMD Antibody (monoclonal, 5A10)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5A10
• Tested applications: FC, ICC, IHC, WB
• Reactivity: Human
• Isotype: Mouse IgG1
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Emerin (1-48aa MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino ac
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 34 kDa
• UniProt ID: P50402
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Emerin; EMD; EDMD; STA
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of A431 cells using anti-Emerin antibody (Blue line).Isotype control antibody (Green line) was mouse IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of Emerin using anti-Emerin antibody.Lane 1:human HeLa cell;2:human placenta tissue;3:human Caco-2 cell;4:human HepG2 cell;5:Rabbit IgG;6:Marker 1113;7:human Jurkat cell.8:human MDA-MB-453 cell;9:human SK-OV-3 cell;10:human SW620 cell.

IHC analysis of Emerin using anti-Emerin antibody.Emerin was detected in paraffin-embedded section of human rectal cancer tissue.

IHC analysis of Emerin using anti-Emerin antibody.Emerin was detected in paraffin-embedded section of human gastric cancer tissue.