You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334536 |
---|---|
Category | Antibodies |
Description | EME1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IHC, IHC-Fr, WB |
Reactivity | Human, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human EME1 (520-561aa DKERQNLLADIQVRRGEGVTSTSRRIGPELSRRIYLQMTTLQ ), different from the related mouse sequence by five amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 63252 MW |
UniProt ID | Q96AY2 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Crossover junction endonuclease EME1;3.1.22.-;MMS4 Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of U20S cells using anti-EME1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of EME1 using anti-EME1 antibody.Lane 1:HELA Cell;2:JURKAT Cell;3:HUT Cell.
IHC analysis of EME1 using anti-EME1 antibody.EME1 was detected in paraffin-embedded section of Rat Intestine Tissue.
IHC analysis of EME1 using anti-EME1 antibody.EME1 was detected in paraffin-embedded section of Human Lung Cancer Tissue.
Filter by Rating