You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580812 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ELOVL5 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ELOVL5 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 35kDa |
Target | ELOVL5 |
UniProt ID | Q9NYP7 |
Protein Sequence | Synthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK |
NCBI | NP_068586 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HELO1, SCA38, dJ483K16.1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: ELOVL5, Sample Tissue: Human Jurkat, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ELOVL5, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ELOVL5, Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. ELOVL5 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.
Host: Rabbit, Target Name: ELOVL5, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that ELOVL5 is expressed in MCF7.
Host: Rabbit, Target: ELOVL5, Positive control (+): 293T Cell Lysate (2T), Negative control (-): Human Ovary Tumor (T-OV), Antibody concentration: 0.2 ug/ml.
WB Suggested Anti-ELOVL5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human heart.
Filter by Rating