EIF6 antibody

• Catalog Number: orb585008
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EIF6
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
• Reactivity: Frog, Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 27kDa
• Target: EIF6
• UniProt ID: P56537
• Protein Sequence: Synthetic peptide located within the following region: AVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHA
• NCBI: NP_002203
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CAB, EIF3A, eIF-6, p27BBP, ITGB4BP, b(2)gcn, p27(B
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: EIF6, Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. EIF6 is supported by BioGPS gene expression data to be expressed in 721_B.

Rabbit Anti-EIF6 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Kidney, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-EIF6 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Skin, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-EIF6 Antibody, Titration: 1.0 ug/ml, Positive Control: Hela Whole Cell. EIF6 is supported by BioGPS gene expression data to be expressed in HeLa.