EIF5A monoclonal antibody (M01), clone 8C1

• Catalog Number: orb2293265
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant EIF5A.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 8C1
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: EIF5A (NP_001961.1, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK
• NCBI: NP_001961.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged EIF5A is 3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to EIF5A on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of EIF5A expression in transfected 293T cell line by EIF5A monoclonal antibody (M01), clone 8C1. Lane 1: EIF5A transfected lysate (16.8 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (43.2 KDa).