You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331174 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EIF3K |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 24kDa |
Target | EIF3K |
UniProt ID | Q9UBQ5 |
Protein Sequence | Synthetic peptide located within the following region: AEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFD |
NCBI | NP_037366 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti ARG134 antibody, anti EIF3-p28 antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
EIF3K antibody - C-terminal region (orb331174) validated by WB using U937 Cell Lysate at 1.0 ug/ml.
Sample Type: 1. Human NT-2 cells (60 ug), 2. mouse brain extracts (80 ug), Primary antibody dilution: 2 ug/ml, Secondary antibody: IRDye 800CW goat anti-rabbit, Secondary antibody dilution: 1:20000.
IH, WB | |
Human, Mouse, Porcine, Primate, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating