EIF3I Rabbit Polyclonal Antibody

• Catalog Number: orb326513
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EIF3I
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, IP, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit
• Reactivity: Human, Mouse, Rat
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 36kDa
• Target: EIF3I
• UniProt ID: Q13347
• Protein Sequence: Synthetic peptide located within the following region: NVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPV
• NCBI: NP_003748
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti EIF3S2 antibody, anti PRO2242 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

EIF3I antibody - C-terminal region (orb326513) validated by WB using HepG2 cell lysate at 1.0 ug/mL.

Sample Type: Human 293T, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.0 ug/mL, Peptide Concentration: 2.0 ug/mL, Lysate Quantity: 25 ug/lane.

Sample Type: Human 293T, Antibody Dilution: 1.0 ug/mL.

Sample Type: 3. rat brain extract (80 ug), Primary antibody Dilution: 2 ug/mL, Secondary antibody: IRDye 800CW goat anti-rabbit, Secondary antibody Dilution: 1:20000.

Sample Type: Mouse brain stem cells, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: EIF3I: Red DAPI:Blue, Gene Name: EIF3I.